Learn More
Invitrogen™ Human CTDSP1 (aa 52-94) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107181
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66511 (PA5-66511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CTDSP1 is a class 2C phosphatase with activity dependent on the conserved DxD motif. Expression of CTDSP1 inhibited activated transcription from several promoter-reporter gene constructs, but expression of a mutant lacking phosphatase activity enhanced transcription. Neuronal gene transcription is repressed in nonneuronal cells by the repressor element-1 (RE1)-silencing transcription factor/neuron-restrictive silencer factor (REST/NRSF; 600571) complex. REST/NRSF recruits SCPs to neuronal genes that contain RE1 elements, leading to neuronal gene silencing in nonneuronal cells. Phosphatase-inactive forms of SCP interfere with REST/NRSF function and promote neuronal differentiation of P19 stem cells. Likewise, small interfering RNA directed to the single Drosophila SCP unmasks neuronal gene expression in S2 cells. Thus, SCP activity is an evolutionarily conserved transcriptional regulator that acts globally to silence neuronal genes.
Especificaciones
Q9GZU7 | |
Blocking Assay, Control | |
58190 | |
100 μL | |
carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; CTD; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; CTD small phosphatase 1; Ctdsp1; GIP; golli-interacting protein; Nif3; Nliif; NLI-IF; NLI-interacting factor 3; Nuclear LIM interactor-interacting factor 3; SCP1; small CTD phosphatase 1; Small C-terminal domain phosphatase 1 | |
CTDSP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CTDSP1 (aa 52-94) Control Fragment | |
RUO | |
CTDSP1 | |
Unconjugated | |
Recombinant | |
EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.