missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Complement C3 (aa 1259-1401) Control Fragment Recombinant Protein

Código de producto. 30196347
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110671 (PA5-110671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C3 is a key component of the complement system since classical and alternative activation pathways merge at the C3 activation step when C3 is split into C3a and C3b. The molecular mass of C3 is 185 kDa and it consists of two chains (110 kDa and 75 kDa) held together by disulfide bonds.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P01024
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 718
Nombre Human Complement C3 (aa 1259-1401) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Acylation stimulating protein; acylation-stimulating protein cleavage product; AHUS5; AI255234; ARMD9; ASP; C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a; C3a anaphylatoxin; C3adesArg; C3b; C3bc; C3-beta-c; C3d; complement C3; Complement C3 alpha chain; Complement C3 beta chain; complement C3 protein (GPC3) precursor; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3c alpha' chain fragment 2; Complement C3d fragment; Complement C3dg fragment; Complement C3f fragment; Complement C3g fragment; complement component 3; complement component C3; complement component C3 alpha-chain; complement component C3a; complement component C3b; complement component C3d; CPAMD1; ENCF-1; ENCF-2; epididymis secretory sperm binding protein Li 62 p; HEL-S-62 p; HSE-MSF; I79_008227; LOC100060539; Neutrophil chemotactic factor-1; Neutrophil chemotactic factor-2; Plp; prepro-C3; Unknown (protein for MGC:134562)
Nombre común Complement C3
Símbolo de gen C3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human Complement C3 (aa 1259-1401) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado