Learn More
Invitrogen™ Human Complement C3 (aa 1259-1401) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95391
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110671 (PA5-110671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
C3 is a key component of the complement system since classical and alternative activation pathways merge at the C3 activation step when C3 is split into C3a and C3b. The molecular mass of C3 is 185 kDa and it consists of two chains (110 kDa and 75 kDa) held together by disulfide bonds.
Especificaciones
P01024 | |
Blocking Assay, Control | |
718 | |
100 μL | |
Acylation stimulating protein; acylation-stimulating protein cleavage product; AHUS5; AI255234; ARMD9; ASP; C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a; C3a anaphylatoxin; C3adesArg; C3b; C3bc; C3-beta-c; C3d; complement C3; Complement C3 alpha chain; Complement C3 beta chain; complement C3 protein (GPC3) precursor; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3c alpha' chain fragment 2; Complement C3d fragment; Complement C3dg fragment; Complement C3f fragment; Complement C3g fragment; complement component 3; complement component C3; complement component C3 alpha-chain; complement component C3a; complement component C3b; complement component C3d; CPAMD1; ENCF-1; ENCF-2; epididymis secretory sperm binding protein Li 62 p; HEL-S-62 p; HSE-MSF; I79_008227; LOC100060539; Neutrophil chemotactic factor-1; Neutrophil chemotactic factor-2; Plp; prepro-C3; Unknown (protein for MGC:134562) | |
C3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Complement C3 (aa 1259-1401) Control Fragment | |
RUO | |
Complement C3 | |
Unconjugated | |
Recombinant | |
QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Certificados
Se requiere un número de lote para mostrar resultados para certificados. Para encontrar su número de lote en pedidos anteriores, utilice el área de estado de pedidos.
Número de lote | Tipo de certificado | Fecha | Catalog Number |
---|---|---|---|
79522385 | Certificado de análisis | 14/06/2025 |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.