missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human COMMD2 (aa 4-86) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110234
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145099 (PA5-145099. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
COMMD2 may modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. may down-regulate activation of NF-kappa-B.
Especificaciones
| Q86X83 | |
| Blocking Assay, Control | |
| 51122 | |
| 100 μL | |
| 1190017G07Rik; AI047739; COMM domain containing 2; COMM domain-containing protein 2; COMMD2; D3Ertd176e; HSPC042; My004; wu:fb12e01; zgc:92665 | |
| COMMD2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human COMMD2 (aa 4-86) Control Fragment | |
| RUO | |
| COMMD2 | |
| Unconjugated | |
| Recombinant | |
| ELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human COMMD2 (aa 4-86) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido