missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human COL1A2 Partial ORF (AAH54498.1, 1257 a.a. - 1366 a.a.) Recombinant Protein with GST-tag at N-terminal Código de producto.: 16106514

Abnova™ Human COL1A2 Partial ORF (AAH54498.1, 1257 a.a. - 1366 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. p-7093571
10 ug, 10 microgramos
Click to view available options
Cantidad:
10 ug
25 ug
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16106514

Marca: Abnova™ H00001278Q01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Used for AP, Array, ELISA, WB-Re

This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. [provided by R. Dalgleish

Sequence: MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Especificaciones

Número de acceso AAH54498.1
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 1278
Peso molecular 37.95kDa
Nombre COL1A2 (Human) Recombinant Protein (Q01)
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 ug
Inmunógeno MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen OI4
Nombre común COL1A2
Símbolo de gen COL1A2
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Abnova™ Human COL1A2 Partial ORF (AAH54498.1, 1257 a.a. - 1366 a.a.) Recombinant Protein with GST-tag at N-terminal >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado