Learn More
Invitrogen™ Human CNFN (aa 56-111) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106498
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65832 (PA5-65832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Especificaciones
Q9BYD5 | |
Blocking Assay, Control | |
84518 | |
100 μL | |
CNFN; cornefied envelope protein cornefilin; cornifelin; PLAC8L2 | |
CNFN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CNFN (aa 56-111) Control Fragment | |
RUO | |
CNFN | |
Unconjugated | |
Recombinant | |
FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.