Learn More
Invitrogen™ Human CLC-5 (aa 1-54) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104545
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64891 (PA5-64891. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function.
Especificaciones
P51795 | |
Blocking Assay, Control | |
1184 | |
100 μL | |
5430408K11Rik; chloride channel 5; chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease); chloride channel ClC5; chloride channel Clc-5; chloride channel CLCN5; chloride channel protein 5; chloride channel, voltage-sensitive 5; chloride transporter ClC-5; chloride voltage-gated channel 5; Clc5; clC-5; CLCK2; CLCN3; CLCN4; Clcn5; D930009B12Rik; DENTS; DXImx42e; H(+)/Cl(-) exchange transporter 5; H(+)/Cl(-) exchange transporter 5-like; hCIC-K2; hClC-K2; NPHL1; NPHL2; Sfc13; T25545; voltage-gated chloride ion channel CLCN5; XLRH; XRN | |
CLCN5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CLC-5 (aa 1-54) Control Fragment | |
RUO | |
CLC-5 | |
Unconjugated | |
Recombinant | |
MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.