Learn More
Invitrogen™ Human cIAP1 (aa 92-209) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101866
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82193 (PA5-82193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals.
Especificaciones
Q13490 | |
Blocking Assay, Control | |
329 | |
100 μL | |
Api1; Api2; apoptosis inhibitor 1; apoptosis inhibitor 2; AW146227; baculoviral IAP repeat containing 2; baculoviral IAP repeat-containing 2; baculoviral IAP repeat-containing 3; baculoviral IAP repeat-containing protein 2; baculoviral IAP repeat-containing protein 2; putative inhibitor of apoptosis; BIRC2; Birc3; cellular inhibitor of apoptosis 1; cIAP1; C-IAP1; cIAP2; HIAP1; HIAP2; Hiap-2; IAP homolog B; IAP1; IAP2; IAP-2; inhibitor of apoptosis protein; inhibitor of apoptosis protein 2; LOC100622859; mcIAP1; MIAP1; MIAP2; mIAP-2; MIHB; MIHC; NFR2-TRAF signalling complex protein; rIAP1; RING finger protein 48; RING-type E3 ubiquitin transferase BIRC2; RNF48; TNFR2-TRAF-signaling complex protein 2 | |
BIRC2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human cIAP1 (aa 92-209) Control Fragment | |
RUO | |
cIAP1 | |
Unconjugated | |
Recombinant | |
NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.