Learn More
Invitrogen™ Human cGKI (aa 233-349) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89820
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82310 (PA5-82310. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PRKG1 is a cGMP-dependent serine/threonine kinase which has an important role in the relaxation of vascular smooth muscle and the inhibition of platelet aggregation. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity.
Especificaciones
Q13976 | |
Blocking Assay, Control | |
5592 | |
100 μL | |
AAT8; AW125416; cGK; cGK 1; CGK 1 alpha; cGK 1 beta; cGK cGK cGKI; cGK cGK1; cGK1; cGKI; cGKI-alpha; cGKI-BETA; cGMP dependent protein kinase type 1; cGMP kinase type I alpha; cGMP-dependent protein kinase 1; cGMP-dependent protein kinase 1, alpha isozyme; cGMP-dependent protein kinase 1, beta isozyme; cGMP-dependent protein kinase I; Gm19690; OTTHUMP00000019618; Pk.; Pkgi; Prkg1; PRKG1B; PRKGR1A; PRKGR1B; protein kinase cGMP-dependent 1; protein kinase, cGMP-dependent, regulatory, type I, beta; protein kinase, cGMP-dependent, type 1; protein kinase, cGMP-dependent, type I; RP11-346D6.1; Unknown (protein for MGC:134126); unnamed protein product | |
PRKG1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human cGKI (aa 233-349) Control Fragment | |
RUO | |
cGKI | |
Unconjugated | |
Recombinant | |
LADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.