Learn More
Invitrogen™ Human CEP192 (aa 2317-2408) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP98209
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58771 (PA5-58771. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CEP192 is required for mitotic centrosome and spindle assembly. Appears to be a major regulator of pericentriolar material (PCM) recruitment, centrosome maturation, and centriole duplication.
Especificaciones
Q8TEP8 | |
Blocking Assay, Control | |
55125 | |
100 μL | |
192 kDa centrosomal protein; centrosomal protein 192; centrosomal protein 192 kDa; centrosomal protein of 192 kDa; CEP192; FLJ10352; KIAA1569; PP8407; PPP1R62; protein phosphatase 1, regulatory subunit 62 | |
CEP192 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CEP192 (aa 2317-2408) Control Fragment | |
RUO | |
CEP192 | |
Unconjugated | |
Recombinant | |
KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.