missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDR1 (aa 70-141) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107909
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67271 (PA5-67271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Autoantibodies directed against the protein encoded by CDR1, an intronless gene, have been found in some patients with paraneoplastic cerebellar degeneration. The encoded protein contains several hexapeptide repeats.
Especificaciones
| P51861 | |
| Blocking Assay, Control | |
| 1038 | |
| 100 μL | |
| 100039759; CDR; CDR1; CDR34; CDR62A; cerebellar degeneration related antigen 1; cerebellar degeneration related protein 1; cerebellar degeneration-related antigen 1; cerebellar degeneration-related protein 1, 34 kDa; EG631990; Gm2409; Gm7077 | |
| CDR1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CDR1 (aa 70-141) Control Fragment | |
| RUO | |
| CDR1 | |
| Unconjugated | |
| Recombinant | |
| SEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human CDR1 (aa 70-141) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido