Learn More
Invitrogen™ Human CDK10 (aa 71-193) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108305
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene.
Especificaciones
Q15131 | |
Blocking Assay, Control | |
8558 | |
100 μL | |
BC017131; CDC2-related protein kinase; Cdk10; Cell division protein kinase 10; cyclin dependent kinase 10; cyclin-dependent kinase (CDC2-like) 10; cyclin-dependent kinase 10; cyclin-dependent kinase related protein; PISSLRE; serine/threonine protein kinase PISSLRE; serine/threonine-protein kinase PISSLRE | |
CDK10 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CDK10 (aa 71-193) Control Fragment | |
RUO | |
CDK10 | |
Unconjugated | |
Recombinant | |
RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.