missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human CD69 (aa 63-126) Control Fragment Recombinant Protein Código de producto.: 30210094

Invitrogen™ Human CD69 (aa 63-126) Control Fragment Recombinant Protein

Código de producto. 30210094
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210094

Marca: Invitrogen™ RP103077

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84010 (PA5-84010. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD69 (AIM, Active Inducer Molecule) is a gp28/34 disulfide bonded homodimer with a molecular weight of 60 kDa under non-reducing conditions. CD69 contains one or two N linked oligosacaride and the molecule is present on activated platelets. In normal peripheral blood a variable percentage of cells express the CD69 antigen, and it is involved in lymphocyte signal transduction. Expression CD69 is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. Alternative splicing results in multiple transcript variants of CD69. Diseases associated with CD69 dysfunction include coccidiodomycosis and asthma.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q07108
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 969
Nombre Human CD69 (aa 63-126) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5830438K24Rik; Activation inducer molecule; activation inducer molecule (AIM/CD69); AI452015; AIM; BL-AC/P26; CD69; CD69 antigen; CD69 antigen (p60, early T-cell activation antigen); CD69 molecule; CLEC2C; C-type lectin domain family 2 member C; C-type lectin domain family 2, member C; EA1; early activation antigen CD69; early lymphocyte activation antigen; early T-cell activation antigen p60; GP32/28; leukocyte surface antigen Leu-23; MLR-3; VEA; Very Early Activation Antigen
Nombre común CD69
Símbolo de gen CD69
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human CD69 (aa 63-126) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado