Learn More
Invitrogen™ Human CD48 (aa 99-161) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106607
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84241 (PA5-84241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CD48 (Blast-1) belongs to the CD2 subset of the Ig superfamily that includes CD2, CD2F-10, CD58, CD84, CD150, CD229, CD244 and others. These molecules bind to the same or another members of the Ig family, thus mediating homotypic or heterotypic adhesion. CD48 is a GPI-anchored protein broadly expressed on hematopoietic cells and serves as a high affinity ligand for 2B4 and low affinity ligand for CD2. 2B4-CD48 interaction among NK cells and NK-T cells regulates cell proliferation. Further, signaling through CD48 results in eosinophil activation and CD48 expression is increased in several infectious diseases. CD48 is strongly expressed on lymphocytes and monocytes, weakly on granulocytes but is absent on platelets, fibroblasts, epithelium and endothelium. CD48 is one of marker for detecting the defects of GPI anchoring structure on the patients with paroxysmal nocturnal hemoglobulinuria (PNH) and serves as a low affinity ligand for CD2. 2B4-CD48 interaction may be involved in the pathology of allergic airway diseases and provide a pharmacological target for the treatment of diseases such as allergic rhinitis and asthma.
Especificaciones
P09326 | |
Blocking Assay, Control | |
962 | |
100 μL | |
AI449234; AW610730; B-cell activation marker; BCM1; Bcm-1; BCM1 surface antigen; BLAST; BLAST1; BLAST-1; B-lymphocyte activation marker BLAST-1; Cd48; CD48 antigen; CD48 antigen (B cell membrane protein); CD48 antigen (B-cell membrane protein); Cd48 molecule; CD48d; hCD48; HM48-1; leukocyte antigen MEM-102; mCD48; MEM-102; MRC OX-45 surface antigen; sCD 48; sCD48; Sgp-60; Signaling lymphocytic activation molecule 2; Signaling lymphocytic activation molecule 2 (SLAMF2); SLAM family member 2; SLAMF2; soluble CD 48; soluble CD48; TCT0.1 | |
Cd48 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CD48 (aa 99-161) Control Fragment | |
RUO | |
CD48 | |
Unconjugated | |
Recombinant | |
VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.