missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human CD11c (aa 596-705) Control Fragment Recombinant Protein Código de producto.: 30209680
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209680

Invitrogen™ Human CD11c (aa 596-705) Control Fragment Recombinant Protein

Código de producto. 30209680
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209680

Marca: Invitrogen™ RP88636

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110685 (PA5-110685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD11, along with CD18, form a heterodimer adhesion molecule. In particular, CD11 is composed of CD11a, CD11b and CD11c. CD11a is a leukocyte marker that is expressed in B and T lymphocytes, macrophages, monocytes, neutrophils, basophils and eosinophils. CD11b is primarily expressed by monocytes, macrophages, natural killer cells, some B and T-cells, and granulocytes. CD11c is expressed in monocytes, macrophages, natural killer cells, some granulocytes and less so in a subset of lymphocytes.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P20702
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3687
Nombre Human CD11c (aa 596-705) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha x (antigen CD11C (p150), alpha polypeptide); integrin, alpha x (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Nombre común CD11c
Símbolo de gen Itgax
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human CD11c (aa 596-705) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado