Learn More
Invitrogen™ Human CAT1 (aa 473-567) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92890
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110860 (PA5-110860. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge. The alternatively splicing of this gene results in three distinct isoforms, one of which contains an N-terminial mitochondrial transit peptide, and has been shown to be located in mitochondria.
Especificaciones
P43155 | |
Blocking Assay, Control | |
1384 | |
100 μL | |
amino acid transporter, cationic 1; ATRC1; AW107812; CARAT; Carnitine acetylase; carnitine acetyltransferase; Carnitine O-acetyltransferase; CAT; CAT1; CAT-1; Crat; Ecotropic retroviral leukemia receptor homolog; ecotropic retroviral receptor; ecotropic retrovirus receptor homolog; ERR; HCAT1; High affinity cationic amino acid transporter 1; REC1L; SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; solute carrier family 7 member 1; System Y+ basic amino acid transporter | |
CRAT | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CAT1 (aa 473-567) Control Fragment | |
RUO | |
CAT1 | |
Unconjugated | |
Recombinant | |
MDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.