missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human CARD14 Partial ORF (NP_077015, 846 a.a. - 945 a.a.) Recombinant Protein with GST-tag at N-terminal Código de producto.: 16119936

Abnova™ Human CARD14 Partial ORF (NP_077015, 846 a.a. - 945 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. 16119936
25 μg, 25 microgramos
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16119936

Marca: Abnova™ H00079092Q01.25ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein shares a similar domain structure with CARD11 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. Two alternatively spliced variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: CLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTHALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTS

Spezifikation

Número de acceso NP_077015
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 79092
Peso molecular 36.74kDa
Nombre CARD14 (Human) Recombinant Protein (Q01)
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 25 μg
Inmunógeno CLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTHALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTS
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen BIMP2/CARMA2
Nombre común CARD14
Símbolo de gen CARD14
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human CARD14 Partial ORF (NP_077015, 846 a.a. - 945 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt