Learn More
Invitrogen™ Human CABIN1 (aa 1720-1800) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95344
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60313 (PA5-60313. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Calcineurin binding protein (Cabin-1) and the corresponding rat homolog, designated Cain, are widely expressed nuclear phosphoproteins that regulate the serine/threonine phosphotase activity of calcineurin and influence T cell signaling and apoptosis. Calcineurin is required for the transcriptional activation of cytokines and the activation of various transcription factors, including NFAT, NFκB and AP-1, involved in T cell receptor (TCR)-mediated signaling. The regulation of calcineurin depends on the changes in intracellular calcium concentrations and the activity of protein kinase C. TCR activation results in PKC inducing the hyperphosphorylation of Cabin-1, which facilitates the high affinity binding of Cabin-1 to calcineurin. This complex formation, in turn, inhibits calcineurin activity and attenuates TCR-mediated signaling. Cabin-1 also associates directly with MEF-2 proteins, a family of transcription factors that regulate apoptosis signaling in T cells. This association between Cabin-1 and MEF-2 leads to the inhibition of MEF-2-mediated gene transcription and the inhibition of apoptosis.
Especificaciones
Q9Y6J0 | |
Blocking Assay, Control | |
23523 | |
100 μL | |
A330070M20Rik; CABIN1; CAIN; calcineurin binding protein 1; calcineurin binding protein cabin 1; calcineurin inhibitor; Calcineurin-binding protein cabin-1; KB-318B8.7; KIAA0330; Ppp3in; protein phosphatase 3 inhibitor | |
CABIN1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CABIN1 (aa 1720-1800) Control Fragment | |
RUO | |
CABIN1 | |
Unconjugated | |
Recombinant | |
EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.