missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CABIN1 (aa 1720-1800) Control Fragment Recombinant Protein

Recombinant Protein

Marca:  Invitrogen™ RP95344

Código de producto. 30207562

  • 265.00€ / 100 microlitros

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Explore más ofertas especiales
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60313 (PA5-60313. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcineurin binding protein (Cabin-1) and the corresponding rat homolog, designated Cain, are widely expressed nuclear phosphoproteins that regulate the serine/threonine phosphotase activity of calcineurin and influence T cell signaling and apoptosis. Calcineurin is required for the transcriptional activation of cytokines and the activation of various transcription factors, including NFAT, NFκB and AP-1, involved in T cell receptor (TCR)-mediated signaling. The regulation of calcineurin depends on the changes in intracellular calcium concentrations and the activity of protein kinase C. TCR activation results in PKC inducing the hyperphosphorylation of Cabin-1, which facilitates the high affinity binding of Cabin-1 to calcineurin. This complex formation, in turn, inhibits calcineurin activity and attenuates TCR-mediated signaling. Cabin-1 also associates directly with MEF-2 proteins, a family of transcription factors that regulate apoptosis signaling in T cells. This association between Cabin-1 and MEF-2 leads to the inhibition of MEF-2-mediated gene transcription and the inhibition of apoptosis.
TRUSTED_SUSTAINABILITY
Especificaciones

Especificaciones

Q9Y6J0
Blocking Assay, Control
23523
100 μL
A330070M20Rik; CABIN1; CAIN; calcineurin binding protein 1; calcineurin binding protein cabin 1; calcineurin inhibitor; Calcineurin-binding protein cabin-1; KB-318B8.7; KIAA0330; Ppp3in; protein phosphatase 3 inhibitor
CABIN1
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human CABIN1 (aa 1720-1800) Control Fragment
RUO
CABIN1
Unconjugated
Recombinant
EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

One moment while we fetch your results.
Certificados
Ofertas especiales

Ofertas especiales

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human CABIN1 (aa 1720-1800) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado