missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C9orf114 (aa 153-269) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP93104
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82808 (PA5-82808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
C9orf114 is a protein coding gene. Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level.
Especificaciones
| Q5T280 | |
| Blocking Assay, Control | |
| 51490 | |
| 100 μL | |
| 9930028P05; AL033358; C9orf114; CENP-32; Centromere protein 32; D2Wsu81e; DNA segment, Chr 2, Wayne State University 81, expressed; HSPC109; Kinetochore-associated protein; LOC499770; Putative methyltransferase C9orf114; putative methyltransferase C9orf114 homolog; similar to LOC495800 protein; SPOUT domain containing methyltransferase 1; SPOUT domain-containing methyltransferase 1; Spout1; uncharacterized protein C9orf114 homolog | |
| SPOUT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C9orf114 (aa 153-269) Control Fragment | |
| RUO | |
| C9orf114 | |
| Unconjugated | |
| Recombinant | |
| QYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human C9orf114 (aa 153-269) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido