Learn More
Invitrogen™ Human c-Myc (aa 286-360) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107507
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The c-Myc protein is a 62 kDa transcription factor that is encoded by the c-Myc gene on human chromosome 8q24. c-Myc is commonly activated in a variety of tumor cells and plays an important role in cellular proliferation, differentiation, apoptosis and cell cycle progression. The phosphorylation of c-Myc has been investigated and previous studies have suggested a functional association between phosphorylation at Thr58/Ser62 by glycogen synthase kinase 3, cyclin dependent kinase, ERK2 and C-Jun N terminal Kinase (JNK) in cell proliferation and cell cycle regulation. Studies have shown that c-Myc is essential for vasculogenesis and angiogenesis in tumor development, which distributes blood throughout the cells. The c-myc oncogene (p62 c-myc) is involved in the control of normal cellular proliferation and differentiation, and the deregulated expression of c-Myc induces apoptosis in different cell types. Antibodies against c-myc epitopes recognize overexpressed proteins containing Myc epitope tag fused to either amino- or carboxy-termini of targeted proteins. c-Myc-, N-Myc- and L-Myc-encoded proteins function in cell proliferation, differentiation and neoplastic disease. Amplification of the c-Myc gene has been found in several types of human tumors including lung, breast and colon carcinomas, while the N-Myc gene has been found amplified in neuroblastomas. Translocation of the c-myc locus on chromosome 8 to the immunoglobulin loci on chromosome 14 (heavy chain); 2 (delta light chain); or 22 (light chain) is described in Burkitts lymphoma and other B-cell lymphoproliferative conditions. An aberrant expression of the c-myc gene occurs in tumors of different origins such as colorectal, gastric, gallbladder, hepatic, mammary, ovarian, endometrial, head and neck, pulmonary, prostatic, thyroidal, oral, ocular, nasopharyngeal, endocrine, as well as hematopoietic neoplasms.
Especificaciones
P01106 | |
Blocking Assay, Control | |
4609 | |
100 μL | |
AU016757; Avian myelocytomatosis viral (v-myc) oncogene homolog; avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; class E basic helix-loop-helix protein 39; cmyc; c-Myc; c-myc epitope tag; c-myc proto-oncogene; mMyc; MRTL; Myc; Myc protein; Myc proto-oncogene protein; MYC proto-oncogene, bHLH transcription factor; Myc2; MYCC; myc-related translation/localization regulatory factor; myelocytomatosis oncogene; myelocytomatosis viral oncogene homolog; Niard; Nird; Proto-oncogene c-Myc; RNCMYC; Transcription factor p64; v-myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene-like protein | |
MYC | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human c-Myc (aa 286-360) Control Fragment | |
RUO | |
c-Myc | |
Unconjugated | |
Recombinant | |
QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.