missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human c-Jun (aa 5-62) Control Fragment Recombinant Protein Código de producto.: 30194471
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30194471

Invitrogen™ Human c-Jun (aa 5-62) Control Fragment Recombinant Protein

Código de producto. 30194471
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194471

Marca: Invitrogen™ RP106940

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-Jun is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P05412
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3725
Nombre Human c-Jun (aa 5-62) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Activator protein 1; AH119; AP1; AP-1; Avian sarcoma virus 17 (v-jun) oncogene homolog; cjun; c-Jun; c-jun transcription factor; enhancer-binding protein AP1; I79_009953; immediate early; JUN; Jun A; Jun activation domain binding protein; Jun oncogene; jun proto-oncogene; Jun proto-oncogene, AP-1 transcription factor subunit; Junc; JUND; p39; proto-oncogene c-Jun; Rjg-9; transcription factor; transcription factor AP-1; V-jun avian sarcoma virus 17 oncogene homolog; v-jun sarcoma virus 17 oncogene homolog
Nombre común c-Jun
Símbolo de gen JUN
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human c-Jun (aa 5-62) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado