Learn More
Invitrogen™ Human BNP (aa 29-81) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110096
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145161 (PA5-145161. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis.
Especificaciones
P16860 | |
Blocking Assay, Control | |
4879 | |
100 μL | |
5 kDa cardiac natriuretic peptide; AA408272; Bnf; BNP; BNP(1-28); BNP(1-29); BNP(1-30); BNP(1-32); BNP(2-31); BNP(3-29); BNP(3-30); BNP(3-32); BNP(4-27); BNP(4-29); BNP(4-30); BNP(4-31); BNP(4-32); BNP(5-29); BNP(5-31); BNP(5-32); BNP-32; BNP-34; Brain natriuretic factor; brain natriuretic peptide; Brain natriuretic peptide 32; Brain natriuretic peptide 45; brain type natriuretic peptide; gamma-brain natriuretic peptide; Iso-ANP; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptide precursor type B; natriuretic peptide type B; natriuretic peptides B; natriuretic protein; Nppb; type-B natriuretic factor | |
Nppb | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human BNP (aa 29-81) Control Fragment | |
RUO | |
BNP | |
Unconjugated | |
Recombinant | |
LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.