missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human beta Synuclein (aa 75-134) Control Fragment Recombinant Protein Código de producto.: 30211088
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211088

Invitrogen™ Human beta Synuclein (aa 75-134) Control Fragment Recombinant Protein

Código de producto. 30211088
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211088

Marca: Invitrogen™ RP96816

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83296 (PA5-83296. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synuclein family of proteins is abundantly expressed in neuronal cytosol and presynaptic terminals. In vertebrates they are encoded by three different genes. Synucleins have been specifically implemented in three major diseases: Alzheimer's (AD), Parkinson's PD) and breast cancer. In AD, a peptide derived from alpha synuclein forms an intrinsic component of plaque amyloid. In PD, an alpha synuclein accumulates in Lewy bodies. An allele of alpha synuclein has been linked to many familial cases of PD. In breast cancer increased expression of gamma synuclein correlates with the disease progression. Synucleins appear to be involved in the membrane plasticity in developing song control system of songbirds.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q16143
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6620
Nombre Human beta Synuclein (aa 75-134) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI838531; betaSYN; beta-synuclein; Phosphoneuroprotein 14; PNP 14; Sncb; synuclein beta; synuclein, beta
Nombre común beta Synuclein
Símbolo de gen SNCB
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human beta Synuclein (aa 75-134) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado