missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCL2L11 Full-length ORF (ENSP00000309226, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. p-7098389
25 μg, 25 microgramos
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family, including BCL2, BCL2L1/BCL-X(L), and MCL1, and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq]

Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK

Especificaciones

Número de acceso ENSP00000309226
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 10018
Peso molecular 38.7kDa
Nombre BCL2L11 (Human) Recombinant Protein (P01)
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 25 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen BAM/BIM/BIM-alpha6/BIM-beta6/BIM-beta7/BOD/BimEL/BimL
Nombre común BCL2L11
Símbolo de gen BCL2L11
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Abnova™ Human BCL2L11 Full-length ORF (ENSP00000309226, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.