missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ATP7A (aa 1102-1223) Control Fragment Recombinant Protein Código de producto.: 30210242

Invitrogen™ Human ATP7A (aa 1102-1223) Control Fragment Recombinant Protein

Código de producto. 30210242
100 μL, 100 microlitros
missing translation for 'orderingAttributeHoverText'
Cantidad:
100 μL
missing translation for 'unitSize'
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210242

Marca: Invitrogen™ RP92226

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53003 (PA5-53003. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP7A (also known as Copper-transporting ATPase 1) functions as a transmembrane copper-translocating P-type ATPase and plays a vital role in systemic copper absorption in the gut and copper reabsorption in the kidney. Polarized epithelial cells such as Madin-Darby canine kidney cells are a physiologically relevant model for systemic copper absorption and reabsorption in vivo. Although ATP7A is not detectable in most normal tissues, it is expressed in a considerable fraction of many common tumor types. Increased expression of ATP7A renders cells resistant to cisplatin and carboplatin. Mutations in the ATP7A gene result in Menkes disease, which is fatal in early childhood.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q04656
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 538
Nombre Human ATP7A (aa 1102-1223) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ATP 7 A; ATP7A; ATPase copper transporting alpha; ATPase, Cu++ transporting, alpha polypeptide; copper pump 1; Copper-transporting ATPase 1; Cu++-transporting P-type ATPase; DSMAX; FLJ17790; MC 1; MC1; Menke; Menkes disease-associated protein; menkes disease-associated protein homolog; Menkes protein; Menkes syndrome; MK; MNK; OHS; OTTHUMP00000062077; SMA x 3
Nombre común ATP7A
Símbolo de gen ATP7A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ATP7A (aa 1102-1223) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado