missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP6V1A (aa 20-113) Control Fragment Recombinant Protein

Código de producto. 30213145
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65138 (PA5-65138. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1A encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P38606
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 523
Nombre Human ATP6V1A (aa 20-113) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 70-kDa subunit; AI647066; Atp6a1; Atp6a2; Atp6v1a; Atp6v1a1; ATPase H+ transporting V1 subunit A; ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha 70 kDa, isoform 2; ATPase, H+ transporting, lysosomal 70 kD, V1 subunit A, isoform 1; ATPase, H+ transporting, lysosomal 70 kDa, V1 subunit A; ATPase, H+ transporting, lysosomal V1 subunit A; ATPase, H+ transporting, lysosomal, subunit A1; ATPase, H+ transporting, V1 subunit A, isoform 1; ATPase, H+ transporting, V1 subunit A1; H(+)-transporting two-sector ATPase, subunit A; H+-transporting ATPase chain A, vacuolar (VA68 type); HO68; lysosomal 70 kDa; VA68; vacuolar ATP synthase catalytic subunit A, ubiquitous isoform; vacuolar ATPase isoform VA68; vacuolar proton pump alpha subunit 1; vacuolar proton pump subunit alpha; V-ATPase 69 kDa subunit; V-ATPase 69 kDa subunit 1; V-ATPase A subunit 1; V-ATPase subunit A; Vma1; VPP2; V-type proton ATPase catalytic subunit A
Nombre común ATP6V1A
Símbolo de gen ATP6V1A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ATP6V1A (aa 20-113) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado