missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ATP Synthase B1 (aa 197-256) Control Fragment Recombinant Protein Código de producto.: 30199229

Invitrogen™ Human ATP Synthase B1 (aa 197-256) Control Fragment Recombinant Protein

Código de producto. 30199229
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199229

Marca: Invitrogen™ RP104194

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63434 (PA5-63434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P24539
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 515
Nombre Human ATP Synthase B1 (aa 197-256) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ATP synthase B chain, mitochondrial; ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase peripheral stalk-membrane subunit b; ATP synthase proton-transporting mitochondrial F(0) complex subunit B1; ATP synthase subunit b; ATP synthase subunit b, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; Atp5f; ATP5F1; Atp5pb; ATPase subunit b; C76477; cell proliferation-inducing protein 47; H+-ATP synthase subunit b; PIG47
Nombre común ATP Synthase B1
Símbolo de gen ATP5PB
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ATP Synthase B1 (aa 197-256) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado