Learn More
Abnova™ Human ATG16L1 Partial ORF (-, 459 a.a. - 541 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
344.00€ - 521.00€
Especificaciones
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
---|---|
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 55054 |
Peso molecular | 34.76kDa |
Nombre | ATG16L1 (Human) Recombinant Protein (Q01) |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16157866
|
Abnova™
H00055054-Q01.25ug |
25 μg |
521.00€
25 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
16147866
|
Abnova™
H00055054-Q01.10ug |
10 μg |
344.00€
10 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM]
Sequence: SGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKEspecificaciones
Antibody Production, ELISA, Protein Array, Western Blot | |
55054 | |
ATG16L1 (Human) Recombinant Protein (Q01) | |
SGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGK | |
RUO | |
ATG16L1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.76kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
APG16L/ATG16L/FLJ00045/FLJ10035/FLJ10828/FLJ22677/IBD10/WDR30 | |
ATG16L1 | |
Recombinant | |
wheat germ expression system |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.