Learn More
Invitrogen™ Human ASK (aa 417-540) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106034
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Activator of S phase kinase (ASK, DBF4) is a novel regulatory subunit of the human Cdc7 kinase complex that plays a pivotal role in G1/S cell cycle transition in mammalian cells. The increase in Cdc7 kinase activity at the G1/S boundary is at least partly accounted for by the elevated expression of ASK in late G1. ASK interacts with replication origins in vivo, suggesting that Cdc7 may trigger S phase by directly activating the replication initiation complexes assembled at the origins. Human ASK protein levels are regulated during the cell cycle with a pattern that matches that of human Cdc7 protein kinase activity. Human Cdc7-ASK kinase is directly involved in regulating the initiation of DNA replication by targeting MCM2 protein in mammalian cells. Nuclear localization and chromatin binding of endogenous huCdc7 and GFP-ASK is presumably imported into nuclei through its two nuclear localization signals at telophase, it may require additional signals for chromatin binding, the level of which increases at late G1 ohase. A functional link may exist between menin, a tumor suppressor protein mutated in multiple endocrine neoplasia type I (MEN1), and ASK in the regulation of cell proliferation.
Especificaciones
Q9UBU7 | |
Blocking Assay, Control | |
10926 | |
100 μL | |
AA545217; Activator of S phase kinase; ASK; CHIF; chiffon homolog A; Dbf4; DBF4 homolog; DBF4 homolog (S. cerevisiae); DBF4 zinc finger; DBF4 zinc finger A; DBF4A; DBF4-type zinc finger-containing protein 1; MuDBF4; Protein DBF4 homolog A; RGD1305854; ZDBF1; zinc finger, DBF-type containing 1 | |
DBF4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ASK (aa 417-540) Control Fragment | |
RUO | |
ASK | |
Unconjugated | |
Recombinant | |
PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.