missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ARPC5 Partial ORF (AAH57237.1, 31 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. [provided by RefSeq]
Sequence: GDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISF
Especificaciones
Especificaciones
Número de acceso | AAH57237.1 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 10092 |
Peso molecular | 32.23kDa |
Nombre | ARPC5 (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 25 μg |
Inmunógeno | GDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISF |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human ARPC5 Partial ORF (AAH57237.1, 31 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal >
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido