missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AROS (aa 68-136) Control Fragment Recombinant Protein

Código de producto. 30198990
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60153 (PA5-60153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AROS, a nucleolar protein with an unknown function, interacts with extra ribosomal protein RPS19, playing a role in the signaling pathways that regulate rRNA transcription. The deduced amino acid sequence of AROS, derived from cDNA, defines an isoelectric point of 11.3. No known functional motifs were found in AROS except a short polylysine tract embedded in a putative nucleolar localization signal. At a basal level the protein is expressed ubiquitously with a significantly high level of expression in some tissues. Human AROS gene is mapped to chromosome 22q13.1.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q86WX3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 91582
Nombre Human AROS (aa 68-136) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2510038A11Rik; 40 S ribosomal protein S19-binding protein 1; Active regulator of SIRT1; AI604923; AROS; dJ1104E15.4; homolog of mouse S19 binding protein; RGD1562823; ribosomal protein S19 binding protein 1; RP5-1104E15.4; RPS19-binding protein 1; RPS19BP1; S19 binding protein; S19BP
Nombre común AROS
Símbolo de gen RPS19BP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human AROS (aa 68-136) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado