Learn More
Invitrogen™ Human ARMC4 (aa 316-407) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97160
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58129 (PA5-58129. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Especificaciones
Q5T2S8 | |
Blocking Assay, Control | |
55130 | |
100 μL | |
armadillo repeat containing 4; armadillo repeat-containing protein 4; ARMC4; CILD23; testis tissue sperm-binding protein Li 74 n | |
ARMC4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ARMC4 (aa 316-407) Control Fragment | |
RUO | |
ARMC4 | |
Unconjugated | |
Recombinant | |
FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.