missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human APEH (aa 65-152) Control Fragment Recombinant Protein Código de producto.: 30205765

Invitrogen™ Human APEH (aa 65-152) Control Fragment Recombinant Protein

Código de producto. 30205765
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30205765

Marca: Invitrogen™ RP95870

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83099 (PA5-83099. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. APEH gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. The protein can play an important role in destroying oxidatively damaged proteins in living cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P13798
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 327
Nombre Human APEH (aa 65-152) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AARE; ACPH; Acylamino-acid-releasing enzyme; acylamino-acid-releasing enzyme-like; acylaminoacyl-peptidase; acylaminoacyl-peptide hydrolase; acylpeptide hydrolase; Acyl-peptide hydrolase; Apeh; APH; cb5; D3F15S2; D3S48E; DNF15S2; LOW QUALITY PROTEIN: acylamino-acid-releasing enzyme; acylamino-acid-releasing enzyme; MGC2178; N-acylaminoacyl peptide hydrolase; N-acylaminoacyl-peptide hydrolase; OPH; Oxidized protein hydrolase; sb:cb5; wu:fi37d02
Nombre común APEH
Símbolo de gen APEH
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human APEH (aa 65-152) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado