Learn More
Invitrogen™ Human APC2 (aa 2221-2292) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP98394
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67486 (PA5-67486. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC2 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. Like APC11, APC2 contains cullin and RING finger domains that are thought to be important in regulating ubiquitination activity.
Especificaciones
O95996 | |
Blocking Assay, Control | |
10297 | |
100 μL | |
9230107K09Rik; adenomatosis polyposis coli 2; adenomatous polyposis coli like; adenomatous polyposis coli protein 2; Adenomatous polyposis coli protein-like; AI852447; AL024279; Anapc2; anaphase promoting complex subunit 2; anaphase-promoting complex subunit 2; APC2; APC2, WNT signaling pathway regulator; APCL; APC-like; Cyclosome subunit 2; EGK_07151; Emi4; expressed during mesenchymal induction 4; Imi4; induced during mesenchymal induction 4; KIAA1406; mKIAA1406; R75424 | |
APC2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human APC2 (aa 2221-2292) Control Fragment | |
RUO | |
APC2 | |
Unconjugated | |
Recombinant | |
GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.