Learn More
Invitrogen™ Human AP3B2 (aa 973-1078) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP98024
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111110 (PA5-111110. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The AP3 complex is a heterotetramer composed of two large adaptins (AP3D1, AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. Unlike the homologous AP3B1, AP3B2-containing AP3 complexes are preferentially targeted to neuronal processes, and mice deficient in AP3B2 displayed compromised synaptic zinc stores.
Especificaciones
Q13367 | |
Blocking Assay, Control | |
8120 | |
100 μL | |
[b]-NAP; adapter-related protein complex 3 subunit beta-2; adaptor protein complex AP-3 beta-2 subunit; adaptor protein complex AP-3 subunit beta-2; adaptor related protein complex 3 beta 2 subunit; adaptor related protein complex 3, beta 2 subunit; adaptor-related protein complex 3 subunit beta-2; adaptor-related protein complex 3, beta 2 subunit; adaptor-related protein complex AP-3, beta 2 subunit; AI549966; ap3; AP-3 complex beta-2 subunit; AP-3 complex subunit beta-2; Ap3b2; AU042881; beta3B; beta-3 B-adaptin; beta3B-adaptin; beta-NAP; Clathrin a; clathrin assembly protein complex 3 beta-2 large chain; NAPTB; Neuronal adaptin-like protein, beta-subunit; neuron-specific vesicle coat protein beta-NAP | |
AP3B2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human AP3B2 (aa 973-1078) Control Fragment | |
RUO | |
AP3B2 | |
Unconjugated | |
Recombinant | |
APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.