Learn More
Abnova™ Human AP2A1 Partial ORF (NP_055018, 824 a.a. - 923 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. [provided by RefSeq]
Especificaciones
Especificaciones
| Número de acceso | NP_055018 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 160 |
| Peso molecular | 36.74kDa |
| Nombre | AP2A1 (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 10 μg |
| Inmunógeno | QVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNP |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.