Learn More
Invitrogen™ Human AMOT (aa 243-306) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108533
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111627 (PA5-111627. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
AMOT (Angiomotin) belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. AMOT plays a central role in tight junction maintenance via the complex formed with ARHGAP17 - which acts by regulating the uptake of polarity proteins at tight junctions. AMOT is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels.
Especificaciones
Q4VCS5 | |
Blocking Assay, Control | |
154796 | |
100 μL | |
AMOT; Angiomotin; angiomotin p130 isoform; angiomotin p80 isoform; CAG-2; D0Kist1; KIAA1071; RGD1564027; si:dkey-13f9.6; Sii6; wu:fj21a07 | |
AMOT | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human AMOT (aa 243-306) Control Fragment | |
RUO | |
AMOT | |
Unconjugated | |
Recombinant | |
PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.