Learn More
Invitrogen™ Human AMFR (aa 305-403) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110225
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. The protein encoded by this gene is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.
Especificaciones
Q9UKV5 | |
Blocking Assay, Control | |
267 | |
100 μL | |
AMF receptor; Amfr; Autocrine motility factor receptor; autocrine motility factor receptor, E3 ubiquitin protein ligase; E3 ubiquitin-protein ligase AMFR; gp78; RING finger protein 45; RING-type E3 ubiquitin transferase AMFR; RNF45 | |
AMFR | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human AMFR (aa 305-403) Control Fragment | |
RUO | |
AMFR | |
Unconjugated | |
Recombinant | |
VQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.