missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ADAMTS13 (aa 1285-1376) Control Fragment Recombinant Protein Código de producto.: 30213418

Invitrogen™ Human ADAMTS13 (aa 1285-1376) Control Fragment Recombinant Protein

Código de producto. 30213418
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30213418

Marca: Invitrogen™ RP108889

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139814 (PA5-139814. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS13 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q76LX8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 11093
Nombre Human ADAMTS13 (aa 1285-1376) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 13; A disintegrin and metalloproteinase with thrombospondin motifs 13-like; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; ADAMs; ADAM-TS 13; ADAMTS13; ADAM-TS13; ADAMTS-13; C9orf8; Gm710; LOC102554393; metalloendopeptidases; UNQ6102/PRO20085; von Willebrand factor-cleaving protease; vWF-cleaving protease; VWFCP; vWF-CP; vWF-CP mRNA for von Willebrand factor-cleaving
Nombre común ADAMTS13
Símbolo de gen ADAMTS13
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ADAMTS13 (aa 1285-1376) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado