missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ADAMTS10 (aa 797-874) Control Fragment Recombinant Protein Código de producto.: 30202590

Invitrogen™ Human ADAMTS10 (aa 797-874) Control Fragment Recombinant Protein

Código de producto. 30202590
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202590

Marca: Invitrogen™ RP93161

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59109 (PA5-59109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS (a disintegrin and metalloproteinase domain with Thrombospondin type-1 modules) is a family of zinc-dependent proteases that are implicated in a variety of normal and pathological conditions, including arthritis and cancer (1-3). Embryogenesis, morphological growth changes, inflammation, tumor invasion and metastasis involve the breakdown and remodeling of the extracellular matrix. This degradation is due to the family of enzymes known as the matrix metalloproteinases (MMPs), which are related to ADAMTS subtypes. ADAMTS protein family members contain an amino-terminal propeptide domain, a metalloproteinase domain, a disintegrin-like domain and a carboxy-terminus that contains a varying number of thrombospondin type-1 (TSP-1) motifs (1-3). ADAMTS genes are primarily expressed in fetal tissues, including the lung, kidney and liver (1-3). The human ADAMTS10 gene maps to chromosome 19p13.3 (4). The human ADAMTS19 gene maps to chromosome 5q31 (1,5).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9H324
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 81794
Nombre Human ADAMTS10 (aa 797-874) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9430006O18; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 10; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 10; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; a disintegrin-like and metalloprotease with thrombospondin type 1 motif, 10; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 10; ADAM metallopeptidase with thrombospondin type 1 motif, 10; ADAMs; ADAM-TS 10; ADAMTS10; Adam-ts10; ADAMTS-10; AW045948; metalloendopeptidases; WMS; WMS1; zinc metalloendopeptidase; Znmp
Nombre común ADAMTS10
Símbolo de gen ADAMTS10
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ADAMTS10 (aa 797-874) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado