Learn More
Abnova™ Human ADAMTS1 Partial ORF (AAH36515, 858 a.a. - 967 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. [provided by RefSeq]
Especificaciones
Especificaciones
Número de acceso | AAH36515 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 9510 |
Peso molecular | 37.84kDa |
Nombre | ADAMTS1 (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 25 μg |
Inmunógeno | WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.