Learn More
Invitrogen™ Human ACOX3 (aa 316-409) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96612
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57423 (PA5-57423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Acyl-Coenzyme A oxidase 3 also know as pristanoyl-CoA oxidase (ACOX3) is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
Especificaciones
O15254 | |
Blocking Assay, Control | |
8310 | |
100 μL | |
Acox3; acyl-CoA oxidase 3, pristanoyl; acyl-Coenzyme A oxidase 3, pristanoyl; BI685180; branched-chain acyl-CoA oxidase; BRCACox; BRCOX; EST-s59; PCOX; Peroxisomal acyl-coenzyme A oxidase 3; PRCOX; Pristanoyl-CoA oxidase | |
ACOX3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ACOX3 (aa 316-409) Control Fragment | |
RUO | |
ACOX3 | |
Unconjugated | |
Recombinant | |
ILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.