missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ACBD3 Partial ORF (NP_073572, 73 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]
Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Especificaciones
Especificaciones
| Número de acceso | NP_073572 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 64746 |
| Peso molecular | 36.63kDa |
| Nombre | ACBD3 (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 10 μg |
| Inmunógeno | RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human ACBD3 Partial ORF (NP_073572, 73 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal >
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido