missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ABCA10 (aa 794-892) Control Fragment Recombinant Protein Código de producto.: 30200431

Invitrogen™ Human ABCA10 (aa 794-892) Control Fragment Recombinant Protein

Código de producto. 30200431
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200431

Marca: Invitrogen™ RP90803

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53186 (PA5-53186. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABCA10 (ATP Binding Cassette Subfamily A Member 10) is a Protein Coding gene. Diseases associated with ABCA10 include Donnai-Barrow Syndrome. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. Gene Ontology (GO) annotations related to this gene include ATPase activity and ATPase activity, coupled to transmembrane movement of substances. An important paralog of this gene is ABCA9.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8WWZ4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10349
Nombre Human ABCA10 (aa 794-892) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ABCA10; ATP binding cassette subfamily A member 10; ATP-binding cassette A10; ATP-binding cassette sub-family A member 10; ATP-binding cassette, sub-family A (ABC1), member 10; EST698739; FKHL6; FREAC2
Nombre común ABCA10
Símbolo de gen ABCA10
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLVHSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ABCA10 (aa 794-892) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado