missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human AAMDC (aa 5-60) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97281
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58164 (PA5-58164. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
AAMDC (C11orf67) may play a role in preadipocyte differentiation and adipogenesis.
Especificaciones
| Q9H7C9 | |
| Blocking Assay, Control | |
| 28971 | |
| 100 μL | |
| 1810020D17Rik; 1810037D19Rik; Aamdc; adipogenesis associated Mth938 domain containing; adipogenesis associated Mth938 domain-containing protein; adipogenesis associated, Mth938 domain containing; C11orf67; C29H11orf67; CK067; hypothetical protein LOC553802; LI2; Mth938 domain-containing protein; PTD015; RGD1561459; Unknown (protein for MGC:133476); UPF0366 protein C11orf67; UPF0366 protein C11orf67 homolog; zgc:112239 | |
| AAMDC | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human AAMDC (aa 5-60) Control Fragment | |
| RUO | |
| AAMDC | |
| Unconjugated | |
| Recombinant | |
| EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human AAMDC (aa 5-60) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido