Abnova™ HSPC196 Recombinant Protein

Name: Abnova&trade; HSPC196 Recombinant Protein
Brand: Abnova&trade;
SKU: 16170093
Price: 528.00 EUR

Marca: Abnova™ H00051524-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16170093

Fecha estimada de envío: 07-11-2023
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH05201
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	43.5
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Inmunógeno	MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR
Alias de gen	HSPC196
Símbolo de gen	TMEM138
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	51524
Nombre	HSPC196 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	TMEM138
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Descripción