Abnova™ HRASLS3 Recombinant Protein

Marca: Abnova™ H00011145-P01.25ug

Código de producto. 16166252

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH01387
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	43.5
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Inmunógeno	MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Alias de gen	AdPLA/H-REV107-1/HRASLS3/HREV107/HREV107-3/MGC118754
Símbolo de gen	PLA2G16
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	11145
Nombre	HRASLS3 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	PLA2G16
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Sugerencias de productos

Descripción