missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HMGB2 Recombinant Protein
Human HMGB2 full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00003148-P01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
- Theoretical MW (kDa): 47.19
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 47.19 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 μg | |
| -80°C | |
| Recombinant |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| Human HMGB2 Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE stained with Coomassie Blue | |
| Wheat Germ (in vitro) | |
| Human | |
| Solution |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ HMGB2 Recombinant Protein > 25μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido