missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HLA-DPB1 (Human) Recombinant Protein
Human HLA-DPB1 full-length ORF ( AAH07963, 30 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00003115-P02.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
- Sequence: RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA
Especificaciones
AAH07963 | |
major histocompatibility complex, class II, DP beta 1 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HLA-DPB1 | |
GST |
3115 | |
Wheat germ expression system | |
25 μg | |
DPB1, HLA-DP1B | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ HLA-DPB1 (Human) Recombinant Protein > Quantity: 25 μg
Spot an opportunity for improvement?Share a Content Correction