Abnova™ GOLGA7 Recombinant Protein

Name: Abnova&trade; GOLGA7 Recombinant Protein
Brand: Abnova&trade;
SKU: 16119662
Price: 528.00 EUR

Marca: Abnova™ H00051125-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16119662

Fecha estimada de envío: 17-07-2023
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH12032
Formato	Solution
ID de gen (Entrez)	51125
Nombre	GOLGA7 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	GOLGA7
Reactividad cruzada	Human
Recombinante	Yes

Para utilizar con (aplicación)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	40.81
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Inmunógeno	MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Alias de gen	GCP16/GOLGA3AP1/GOLGA7A/HSPC041/MGC21096/MGC4876
Símbolo de gen	GOLGA7
Especie del huésped	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Descripción