Abnova™ GKN1 Recombinant Protein

Human GKN1 full-length ORF recombinant protein with GST-tag at N-terminal

344.00€ - 521.00€

Especificaciones

Número de acceso	AAH59778
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez)	56287
Peso molecular	43.89

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16172183 Ver documentos missing translation for 'viewProductCertificates'	Abnova™ H00056287-P01.10ug	10 μg	344.00€ 10 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16182183 Ver documentos missing translation for 'viewProductCertificates'	Abnova™ H00056287-P01.25ug	25 μg	521.00€ 25 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.

Theoretical MW (kDa): 43.89
Preparation method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH59778
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	43.89
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	GKN1
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	56287
Nombre	GKN1 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Alias de gen	AMP18/BRICD1/CA11/FOV/MGC70354/foveolin
Símbolo de gen	GKN1
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

¿Detecta una oportunidad de mejora?Comparta una corrección de contenido

Volver al principio de esta página

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Abnova™ GKN1 Recombinant Protein

Su nombre

Dirección de correo electrónico *

Tipo de problema *

Descripción detallada del problema/solicitud *

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Cancelar Enviar

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado

Abnova™ GKN1 Recombinant Protein

Especificaciones

Descripción

Especificaciones

Documentos